PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055018.110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 216aa    MW: 24257.3 Da    PI: 8.383
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055018.110genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.11.3e-3055107457
    ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                    ++Y+eC+kNhAa++Gg+a DGCgEfmp  geegt +alkC+AC+CHRnFHRre 
  EcC055018.110  55 TKYRECQKNHAAAIGGNARDGCGEFMPG-GEEGTLDALKCSACNCHRNFHRREI 107
                    68*************************9.999********************96 PP

2Homeobox23.31.1e-07153208152
                    TT--SS--HHHHHHHHHHHH.....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFe.....knrypsaeereeLAkklgLterqVkvWFqNrR 52 
                    rr Rt+ft++q e + + F+     + +++++++ e+L ++lg++ r+ kvW +N +
  EcC055018.110 153 RRYRTKFTAQQKEKMLA-FAtkagwRMQKLDEHAVERLCQELGIERRVLKVWMHNNK 208
                    899***********976.555888789****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-2153107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.1E-2855107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.2E-2956107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.80357106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.47E-20142210IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-29146210IPR009057Homeodomain-like
PROSITE profilePS500718.535150214IPR001356Homeobox domain
TIGRFAMsTIGR015652.4E-25152208IPR006455Homeodomain, ZF-HD class
PfamPF000462.8E-5153208IPR001356Homeobox domain
CDDcd000864.79E-4153206No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006508Biological Processproteolysis
GO:0006886Biological Processintracellular protein transport
GO:0007165Biological Processsignal transduction
GO:0015074Biological ProcessDNA integration
GO:0055114Biological Processoxidation-reduction process
GO:0005622Cellular Componentintracellular
GO:0003677Molecular FunctionDNA binding
GO:0004252Molecular Functionserine-type endopeptidase activity
GO:0005515Molecular Functionprotein binding
GO:0008198Molecular Functionferrous iron binding
GO:0008270Molecular Functionzinc ion binding
GO:0016491Molecular Functionoxidoreductase activity
GO:0043531Molecular FunctionADP binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MSQAGDKPMQ SSRSSSDDID GQVLPRSPPP YIQLREDHDR KREPSLDGGE GSGVTKYREC  60
QKNHAAAIGG NARDGCGEFM PGGEEGTLDA LKCSACNCHR NFHRREILAV HPLNVDASGG  120
LTLHLLKLDP TDSPTDNDGD ETPKVEVVEK KKRRYRTKFT AQQKEKMLAF ATKAGWRMQK  180
LDEHAVERLC QELGIERRVL KVWMHNNKHN YLPGNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-221532101875ZF-HD homeobox family protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1149153KKKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027493.11e-161PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ2QW441e-51ZHD3_ORYSJ; Zinc-finger homeodomain protein 3
TrEMBLA0A059AK371e-161A0A059AK37_EUCGR; Uncharacterized protein
STRINGGLYMA20G35690.22e-62(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-46homeobox protein 22